SCOPe 2.08: Domain d1bl9b2: 1bl9 B:118-543

Lineage for d1bl9b2 (1bl9 B:118-543)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family)

5. Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)

6. Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species)
   the N-terminal domain is cytochrome c-like

7. Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)

8. Domain d1bl9b2: 1bl9 B:118-543 [27707]
   Other proteins in same PDB: d1bl9a1, d1bl9b1
   complexed with dhe, hec, oh

Details for d1bl9b2

PDB Entry: 1bl9, 2.9 Å

PDB Description: conformational changes occurring upon reduction in nitrite reductase from pseudomonas aeruginosa

PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1bl9b2:

Sequence; same for both SEQRES and ATOM records:

>d1bl9b2 b.70.2.1 (B:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

Timeline for d1bl9b2:

• d1bl9b2 first appeared (with stable ids) in SCOP 1.55
  
• d1bl9b2 appears in SCOPe 2.07