Lineage for d5ampa_ (5amp A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781267Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1781325Protein automated matches [190170] (12 species)
    not a true protein
  7. 1781330Species Galactomyces candidum [TaxId:1173061] [277062] (3 PDB entries)
  8. 1781333Domain d5ampa_: 5amp A: [277063]
    automated match to d1gpia_
    complexed with gol, nag, peg

Details for d5ampa_

PDB Entry: 5amp (more details), 2.12 Å

PDB Description: geotrichum candidum cel7a apo structure at 2.1a
PDB Compounds: (A:) cellobiohydrolase I

SCOPe Domain Sequences for d5ampa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ampa_ b.29.1.10 (A:) automated matches {Galactomyces candidum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepasnsansglggngsccaeldiweansisaaltphsadtvtqtvcng
ddcggtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnl
neikrfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnaf
kagmvlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasay
viysnikvgpinstfsgt

SCOPe Domain Coordinates for d5ampa_:

Click to download the PDB-style file with coordinates for d5ampa_.
(The format of our PDB-style files is described here.)

Timeline for d5ampa_: