Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Anaplasma marginale [TaxId:770] [277056] (1 PDB entry) |
Domain d4zinb_: 4zin B: [277058] automated match to d3lf3a_ complexed with edo, so4 |
PDB Entry: 4zin (more details), 1.67 Å
SCOPe Domain Sequences for d4zinb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zinb_ d.22.1.1 (B:) automated matches {Anaplasma marginale [TaxId: 770]} aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk pvqlpgaynvniklditshnedytiveqyeraegrhstg
Timeline for d4zinb_: