Lineage for d4zinc_ (4zin C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899154Species Anaplasma marginale [TaxId:770] [277056] (1 PDB entry)
  8. 1899157Domain d4zinc_: 4zin C: [277057]
    automated match to d3lf3a_
    complexed with edo, so4

Details for d4zinc_

PDB Entry: 4zin (more details), 1.67 Å

PDB Description: genetically encoded phenyl azide photochemistry drive positive and negative functional modulation of a red fluorescent protein
PDB Compounds: (C:) MCherry fluorescent protein

SCOPe Domain Sequences for d4zinc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zinc_ d.22.1.1 (C:) automated matches {Anaplasma marginale [TaxId: 770]}
aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk
pvqlpgaynvniklditshnedytiveqyeraegrhstg

SCOPe Domain Coordinates for d4zinc_:

Click to download the PDB-style file with coordinates for d4zinc_.
(The format of our PDB-style files is described here.)

Timeline for d4zinc_: