Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [224971] (3 PDB entries) |
Domain d4zrna_: 4zrn A: [277054] automated match to d4egba_ complexed with nad, upg |
PDB Entry: 4zrn (more details), 2 Å
SCOPe Domain Sequences for d4zrna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrna_ c.2.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]} mnilvtggagfigshvvdkliengygvivvdnlssgkvenlnrnalfyeqsiedeemmer ifslhrpeyvfhlaaqasvaisvrepardaktniigslvlleksikygvkkfifsstgga iygenvkvfptpeteiphpispygiakystemyleffareyglkytvlryanvygprqdp ygeagvvaiftermlrgeevhifgdgeyvrdyvyvddvvranllamekgdnevfnigtgr gttvnqlfkllkeitgydkepvykpprkgdvrksildytkakeklgwepkvsleeglklt veyfrktle
Timeline for d4zrna_: