Lineage for d4yv0d_ (4yv0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895098Species Trypanosoma cruzi [TaxId:353153] [188400] (13 PDB entries)
  8. 2895120Domain d4yv0d_: 4yv0 D: [277047]
    automated match to d2o06a_
    complexed with 4jw, s4m

Details for d4yv0d_

PDB Entry: 4yv0 (more details), 1.95 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with (2s)-n-methyl-n-phenyl-2,3-dihydro-1,4-benzodioxine- 2- carboxamid
PDB Compounds: (D:) Spermidine synthase, putative

SCOPe Domain Sequences for d4yv0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yv0d_ c.66.1.0 (D:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
elisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciq
vtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevm
eqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfgeaf
ykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsigt
lvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d4yv0d_:

Click to download the PDB-style file with coordinates for d4yv0d_.
(The format of our PDB-style files is described here.)

Timeline for d4yv0d_: