Lineage for d1n90a2 (1n90 A:118-543)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803668Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1803728Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 1803729Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 1803730Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 1803759Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 1803769Domain d1n90a2: 1n90 A:118-543 [27704]
    Other proteins in same PDB: d1n90a1, d1n90b1
    complexed with dhe, hec

Details for d1n90a2

PDB Entry: 1n90 (more details), 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1n90a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n90a2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOPe Domain Coordinates for d1n90a2:

Click to download the PDB-style file with coordinates for d1n90a2.
(The format of our PDB-style files is described here.)

Timeline for d1n90a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n90a1