Lineage for d4yv1a_ (4yv1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130945Species Trypanosoma cruzi [TaxId:353153] [188400] (11 PDB entries)
  8. 2130954Domain d4yv1a_: 4yv1 A: [277038]
    automated match to d2o06a_
    complexed with 4k2, s4m

Details for d4yv1a_

PDB Entry: 4yv1 (more details), 1.85 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with quinolin-8-yl piperidine-1-carboxylate
PDB Compounds: (A:) Spermidine synthase, putative

SCOPe Domain Sequences for d4yv1a_:

Sequence, based on SEQRES records: (download)

>d4yv1a_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
gwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdyd
efvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskq
hfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfgeafykdvl
rilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcsk
kagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

Sequence, based on observed residues (ATOM records): (download)

>d4yv1a_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
gwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldgciqvtdyd
efvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidgevmeqskq
hfpqisrsladpratvrvgdglafvrqtpdntydvviidttafykdvlrilkpdgiccnq
gesiwldleliekmsrfiretgfasvqyalmhvptypcgsigtlvcskkagvdvtkplrp
vedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d4yv1a_:

Click to download the PDB-style file with coordinates for d4yv1a_.
(The format of our PDB-style files is described here.)

Timeline for d4yv1a_: