Lineage for d4y64a_ (4y64 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506312Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2506448Protein automated matches [190178] (2 species)
    not a true protein
  7. 2506455Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2506511Domain d4y64a_: 4y64 A: [277026]
    automated match to d3v0qa_
    complexed with 48c, bhe

Details for d4y64a_

PDB Entry: 4y64 (more details), 1.6 Å

PDB Description: aaglyb in complex with amino-acid analogues
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d4y64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y64a_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftav

SCOPe Domain Coordinates for d4y64a_:

Click to download the PDB-style file with coordinates for d4y64a_.
(The format of our PDB-style files is described here.)

Timeline for d4y64a_: