SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4xowa_ (4xow A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164737Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2164743Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (175 PDB entries)
    Uniprot P42212
  8. 2164808Domain d4xowa_: 4xow A: [277024]
    automated match to d2o24a_

Details for d4xowa_

PDB Entry: 4xow (more details), 1.25 Å

PDB Description: structure of rsgreen0.7 in the green-on-state
PDB Compounds: (A:) rsGreen0.7

SCOPe Domain Sequences for d4xowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xowa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvlcfarypdhmkqhdffksampegyvqertisfkddgyyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnayitadkqkngiksnfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqnklskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d4xowa_:

Click to download the PDB-style file with coordinates for d4xowa_.
(The format of our PDB-style files is described here.)

Timeline for d4xowa_: