![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) ![]() |
![]() | Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein) |
![]() | Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species) the N-terminal domain is cytochrome c-like |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries) |
![]() | Domain d1n15a2: 1n15 A:118-543 [27702] Other proteins in same PDB: d1n15a1, d1n15b1 |
PDB Entry: 1n15 (more details), 2.9 Å
SCOP Domain Sequences for d1n15a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n15a2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn tqhdvy
Timeline for d1n15a2: