Lineage for d3wz0e_ (3wz0 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850756Superfamily c.6.3: PHP domain-like [89550] (3 families) (S)
  5. 2850779Family c.6.3.0: automated matches [277008] (1 protein)
    not a true family
  6. 2850780Protein automated matches [277009] (1 species)
    not a true protein
  7. 2850781Species Thermococcus kodakarensis [TaxId:69014] [277010] (2 PDB entries)
  8. 2850783Domain d3wz0e_: 3wz0 E: [277014]
    Other proteins in same PDB: d3wz0a_, d3wz0c_
    automated match to d2czvb_

Details for d3wz0e_

PDB Entry: 3wz0 (more details), 2.79 Å

PDB Description: on archaeal homologs of the human rnase p proteins pop5 and rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
PDB Compounds: (E:) Ribonuclease P protein component 3

SCOPe Domain Sequences for d3wz0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wz0e_ c.6.3.0 (E:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
yfvemdvrdeeahelasdwfdevvftkklvledppdwgslkeelkelrgkygkvalllvt
rkpslirevksrnlkallyvqggdmrinrmaiesgvdalispwfgrkdpgfdhtlagmaa
rrgvaigfslspllnanpygraqilrfmmktwqlvkkyrvprfitssaesrwevrgprdl
mslginigmeipearaslnfyprtiv

SCOPe Domain Coordinates for d3wz0e_:

Click to download the PDB-style file with coordinates for d3wz0e_.
(The format of our PDB-style files is described here.)

Timeline for d3wz0e_: