Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.3: PHP domain-like [89550] (3 families) |
Family c.6.3.0: automated matches [277008] (1 protein) not a true family |
Protein automated matches [277009] (1 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [277010] (2 PDB entries) |
Domain d3wyza_: 3wyz A: [277013] automated match to d2czvb_ complexed with gol |
PDB Entry: 3wyz (more details), 2.21 Å
SCOPe Domain Sequences for d3wyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyza_ c.6.3.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} fsrdyfvemdvrdeeahelasdwfdevvftkklvledppdwgslkeelkelrgkygkval llvtrkpslirevksrnlkallyvqggdmrinrmaiesgvdalispwfgrkdpgfdhtla gmaarrgvaigfslspllnanpygraqilrfmmktwqlvkkyrvprfitssaesrwevrg prdlmslginigmeipearaslnfyprtivwk
Timeline for d3wyza_: