Lineage for d3wz0c_ (3wz0 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522926Superfamily d.58.59: Rnp2-like [160350] (1 family) (S)
    contains extra C-terminal helix
    automatically mapped to Pfam PF01900
  5. 2522927Family d.58.59.1: Rpp14/Pop5-like [160351] (2 proteins)
    Pfam PF01900
  6. 2522938Protein automated matches [277005] (1 species)
    not a true protein
  7. 2522939Species Thermococcus kodakarensis [TaxId:69014] [277006] (1 PDB entry)
  8. 2522941Domain d3wz0c_: 3wz0 C: [277007]
    Other proteins in same PDB: d3wz0e_, d3wz0f_
    automated match to d2czvd_

Details for d3wz0c_

PDB Entry: 3wz0 (more details), 2.79 Å

PDB Description: on archaeal homologs of the human rnase p proteins pop5 and rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
PDB Compounds: (C:) Ribonuclease P protein component 2

SCOPe Domain Sequences for d3wz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wz0c_ d.58.59.1 (C:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
knryiafqvigerpfkkdeikkavweaslsalgylgsarakpwfikfdeksqtgivrvdr
khveelrfaltmlteingskvifrtlgvsgtikrlkrkflaeygw

SCOPe Domain Coordinates for d3wz0c_:

Click to download the PDB-style file with coordinates for d3wz0c_.
(The format of our PDB-style files is described here.)

Timeline for d3wz0c_: