SCOPe 2.08: Domain d4wepb1: 4wep B:24-305

Lineage for d4wepb1 (4wep B:24-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [276996] (1 PDB entry)

8. Domain d4wepb1: 4wep B:24-305 [277002]
   Other proteins in same PDB: d4wepb2
   automated match to d4ne4a_

Details for d4wepb1

PDB Entry: 4wep, 1.5 Å

PDB Description: apo yehz from escerichia coli

PDB Compounds: (B:) Putative osmoprotectant uptake system substrate-binding protein OsmF

SCOPe Domain Sequences for d4wepb1:

Sequence; same for both SEQRES and ATOM records:

>d4wepb1 c.94.1.0 (B:24-305) automated matches {Escherichia coli [TaxId: 511145]}
aspvkvgskidtegallgniilqvleshgvptvnkvqlgttpvvrgaitsgeldiypeyt
gngafffkdendaawknaqqgyekvkkldsehnkliwltpapanntwtiavrqdvaeknk
ltsladlsrylqeggtfklaasaefieradalpafekaygfklgqdqllslaggdtavti
kaaaqqtsgvnaamaygtdgpvaalglqtlsdpqgvqpiyapapvvresvlreypqmaqw
lqpvfasldaktlqqlnasiavegldakkvaadylkqkgwtk

Timeline for d4wepb1:

• d4wepb1 first appeared in SCOPe 2.05, called d4wepb_
  
• d4wepb1 appears in SCOPe 2.07