Lineage for d4wfva_ (4wfv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804405Protein Lipocalin allergen [50824] (2 species)
  7. 2804406Species Cow (Bos taurus), bos d 2 [TaxId:9913] [50825] (3 PDB entries)
  8. 2804407Domain d4wfva_: 4wfv A: [277001]
    automated match to d1bj7a_

Details for d4wfva_

PDB Entry: 4wfv (more details), 1.4 Å

PDB Description: bovine allergen bos d 2 in the monoclinic space group c2.
PDB Compounds: (A:) Allergen Bos d 2

SCOPe Domain Sequences for d4wfva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wfva_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]}
paeidpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdqgtc
llltevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakgtsf
tpeelekyqqlnsergvpnenienliktdncpp

SCOPe Domain Coordinates for d4wfva_:

Click to download the PDB-style file with coordinates for d4wfva_.
(The format of our PDB-style files is described here.)

Timeline for d4wfva_: