Lineage for d1nnoa2 (1nno A:118-543)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066644Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 2066645Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 2066646Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 2066675Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 2066681Domain d1nnoa2: 1nno A:118-543 [27700]
    Other proteins in same PDB: d1nnoa1, d1nnob1
    complexed with dhe, hec, no

Details for d1nnoa2

PDB Entry: 1nno (more details), 2.65 Å

PDB Description: conformational changes occurring upon no binding in nitrite reductase from pseudomonas aeruginosa
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1nnoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnoa2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOPe Domain Coordinates for d1nnoa2:

Click to download the PDB-style file with coordinates for d1nnoa2.
(The format of our PDB-style files is described here.)

Timeline for d1nnoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnoa1