Lineage for d4wefb_ (4wef B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065275Species Human parainfluenza virus 3 [TaxId:11216] [270133] (5 PDB entries)
  8. 2065279Domain d4wefb_: 4wef B: [276998]
    automated match to d4mzab_
    complexed with bma, ca, df4, fsi, fuc, nag, sfj, so4

Details for d4wefb_

PDB Entry: 4wef (more details), 2.5 Å

PDB Description: structure of the hemagglutinin-neuraminidase from human parainfluenza virus type iii: complex with difluorosialic acid
PDB Compounds: (B:) hemagglutinin-neuraminidase glycoprotein

SCOPe Domain Sequences for d4wefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wefb_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdkglnsipklkvwtismrqnywggegrllllgnkiyiytrstswhsklqlgiiditd
ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
lfkteipkscs

SCOPe Domain Coordinates for d4wefb_:

Click to download the PDB-style file with coordinates for d4wefb_.
(The format of our PDB-style files is described here.)

Timeline for d4wefb_: