Lineage for d3vdha_ (3vdh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419332Species Prevotella bryantii [TaxId:77095] [276992] (6 PDB entries)
  8. 2419337Domain d3vdha_: 3vdh A: [276994]
    automated match to d4im4a_
    complexed with cl

Details for d3vdha_

PDB Entry: 3vdh (more details), 1.62 Å

PDB Description: crystal structure of pbgh5a, a glycoside hydrolase family 5 enzyme from prevotella bryantii b14
PDB Compounds: (A:) B-1,4-endoglucanase

SCOPe Domain Sequences for d3vdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdha_ c.1.8.0 (A:) automated matches {Prevotella bryantii [TaxId: 77095]}
tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
ntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaadq
aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn

SCOPe Domain Coordinates for d3vdha_:

Click to download the PDB-style file with coordinates for d3vdha_.
(The format of our PDB-style files is described here.)

Timeline for d3vdha_: