Lineage for d4rzha_ (4rzh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096044Species Synechocystis sp. [TaxId:1148] [276989] (2 PDB entries)
  8. 2096045Domain d4rzha_: 4rzh A: [276990]
    automated match to d3ennd_

Details for d4rzha_

PDB Entry: 4rzh (more details), 2.2 Å

PDB Description: crystal structure of fabg from synechocystis sp. pcc 6803
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4rzha_:

Sequence, based on SEQRES records: (download)

>d4rzha_ c.2.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
altaqvalvtgasrgigkatalalaatgmkvvvnyaqsstaadavvaeiianggeaiavq
anvanadevdqlikttldkfsridvlvnnagitrdtlllrmkledwqavidlnltgvflc
tkavsklmlkqksgriinitsvagmmgnpgqanysaakagvigftktvakelasrgvtvn
avapgfiatdmtenlnaepilqfiplarygqpeevagtirflatdpaaayitgqtfnvdg
gmvm

Sequence, based on observed residues (ATOM records): (download)

>d4rzha_ c.2.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
altaqvalvtgasrgigkatalalaatgmkvvvnyaqsstaadavvaeiianggeaiavq
anvanadevdqlikttldkfsridvlvnnagitrdtlllrmkledwqavidlnltgvflc
tkavsklmlkqksgriinitsvagmmgnpgqanysaakagvigftktvakelasrgvtvn
avapgfiapilqfiplarygqpeevagtirflatdpaaayitgqtfnvdggmvm

SCOPe Domain Coordinates for d4rzha_:

Click to download the PDB-style file with coordinates for d4rzha_.
(The format of our PDB-style files is described here.)

Timeline for d4rzha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4rzhb_