Lineage for d1nirb2 (1nir B:118-543)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17239Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 17252Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 17253Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 17254Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
  7. 17275Species Pseudomonas aeruginosa [TaxId:287] [51008] (6 PDB entries)
  8. 17277Domain d1nirb2: 1nir B:118-543 [27699]
    Other proteins in same PDB: d1nira1, d1nirb1

Details for d1nirb2

PDB Entry: 1nir (more details), 2.15 Å

PDB Description: oxydized nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1nirb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nirb2 b.70.2.1 (B:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOP Domain Coordinates for d1nirb2:

Click to download the PDB-style file with coordinates for d1nirb2.
(The format of our PDB-style files is described here.)

Timeline for d1nirb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nirb1