Lineage for d1nira2 (1nir A:118-543)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675578Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 675614Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 675615Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 675616Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 675645Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 675646Domain d1nira2: 1nir A:118-543 [27698]
    Other proteins in same PDB: d1nira1, d1nirb1

Details for d1nira2

PDB Entry: 1nir (more details), 2.15 Å

PDB Description: oxydized nitrite reductase from pseudomonas aeruginosa
PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1nira2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nira2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOP Domain Coordinates for d1nira2:

Click to download the PDB-style file with coordinates for d1nira2.
(The format of our PDB-style files is described here.)

Timeline for d1nira2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nira1