![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) ![]() |
![]() | Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein) |
![]() | Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species) the N-terminal domain is cytochrome c-like |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries) |
![]() | Domain d1nira2: 1nir A:118-543 [27698] Other proteins in same PDB: d1nira1, d1nirb1 complexed with cl, dhe, hec, oh, po4 |
PDB Entry: 1nir (more details), 2.15 Å
SCOPe Domain Sequences for d1nira2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nira2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn tqhdvy
Timeline for d1nira2: