Lineage for d2msya_ (2msy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691991Domain d2msya_: 2msy A: [276978]
    automated match to d1pufa_

Details for d2msya_

PDB Entry: 2msy (more details)

PDB Description: solution structure of hox homeodomain
PDB Compounds: (A:) Homeobox protein Hox-C9

SCOPe Domain Sequences for d2msya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msya_ a.4.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anwiharstrkkrcpytkyqtlelekeflfnmyltrdrryevarvlnlterqvkiwfqnr
rmkmkkmn

SCOPe Domain Coordinates for d2msya_:

Click to download the PDB-style file with coordinates for d2msya_.
(The format of our PDB-style files is described here.)

Timeline for d2msya_: