SCOPe 2.05: Domain d5cyic_: 5cyi C:

Lineage for d5cyic_ (5cyi C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (348 PDB entries)
   Uniprot P24941

8. Domain d5cyic_: 5cyi C: [276975]
   Other proteins in same PDB: d5cyib1, d5cyib2, d5cyid1, d5cyid2
   automated match to d1h1pa_
   complexed with 55s

Details for d5cyic_

PDB Entry: 5cyi, 2 Å

PDB Description: cdk2/cyclin a covalent complex with 6-(cyclohexylmethoxy)-n-(4- (vinylsulfonyl)phenyl)-9h-purin-2-amine (nu6300)

PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d5cyic_:

Sequence; same for both SEQRES and ATOM records:

>d5cyic_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d5cyic_:

• d5cyic_ is new in SCOPe 2.05-stable
  
• d5cyic_ is called d5cyic1 in SCOPe 2.06
  
• d5cyic_ appears in the current release, SCOPe 2.08, called d5cyic1