SCOPe 2.07: Domain d5di9a_: 5di9 A:

Lineage for d5di9a_ (5di9 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (87 PDB entries)

8. Domain d5di9a_: 5di9 A: [276973]
   Other proteins in same PDB: d5di9b_
   automated match to d2mmca_
   complexed with cl, gnp, gol, mg, zn; mutant

Details for d5di9a_

PDB Entry: 5di9, 2.28 Å

PDB Description: crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5di9a_:

Sequence; same for both SEQRES and ATOM records:

>d5di9a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

Timeline for d5di9a_:

• d5di9a_ first appeared in SCOPe 2.05
  
• d5di9a_ appears in SCOPe 2.06
  
• d5di9a_ appears in the current release, SCOPe 2.08