Lineage for d5dh9a_ (5dh9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867618Protein Ran [52609] (2 species)
  7. 2867639Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)
  8. 2867735Domain d5dh9a_: 5dh9 A: [276970]
    Other proteins in same PDB: d5dh9b_
    automated match to d2mmca_
    complexed with gnp, gol, mg; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d5dh9a_

PDB Entry: 5dh9 (more details), 2.55 Å

PDB Description: crystal structure of pki nes flip mutant peptide in complex with crm1- ran-ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5dh9a_:

Sequence, based on SEQRES records: (download)

>d5dh9a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d5dh9a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappedp
alaaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5dh9a_:

Click to download the PDB-style file with coordinates for d5dh9a_.
(The format of our PDB-style files is described here.)

Timeline for d5dh9a_: