Lineage for d1aofb2 (1aof B:134-567)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17239Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 17252Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 17253Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 17254Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
  7. 17260Species Paracoccus pantotrophus [TaxId:82367] [51007] (7 PDB entries)
  8. 17274Domain d1aofb2: 1aof B:134-567 [27697]
    Other proteins in same PDB: d1aofa1, d1aofb1

Details for d1aofb2

PDB Entry: 1aof (more details), 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

SCOP Domain Sequences for d1aofb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aofb2 b.70.2.1 (B:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
ppefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvl
dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
vnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtke
gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
tgkfnvyntmtdty

SCOP Domain Coordinates for d1aofb2:

Click to download the PDB-style file with coordinates for d1aofb2.
(The format of our PDB-style files is described here.)

Timeline for d1aofb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aofb1