SCOPe 2.06: Domain d5dlcc_: 5dlc C:

Lineage for d5dlcc_ (5dlc C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families)

5. Family c.1.24.0: automated matches [191640] (1 protein)
   not a true family

6. Protein automated matches [191177] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [276963] (1 PDB entry)

8. Domain d5dlcc_: 5dlc C: [276965]
   automated match to d3gk0a_
   complexed with po4

Details for d5dlcc_

PDB Entry: 5dlc, 2.65 Å

PDB Description: x-ray crystal structure of a pyridoxine 5-prime-phosphate synthase from pseudomonas aeruginosa

PDB Compounds: (C:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d5dlcc_:

Sequence; same for both SEQRES and ATOM records:

>d5dlcc_ c.1.24.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
trillgvnidhvatlrqargtrypdpvkaaldaeeagadgitvhlredrrhiqerdvrvl
kevlqtrmnfemgvteemlafaeeirpahsclvperreeltteggldvagqeqrirdavr
rlaavgsevslfidpdprqieasarvgapaielhtgryadaedpeeqarelqrvregval
grslglivnaghglhyhnvepvaaidginelnighaivahalfvgfrqavaemkalmlaa
at

Timeline for d5dlcc_:

• d5dlcc_ first appeared in SCOPe 2.05
  
• d5dlcc_ appears in SCOPe 2.07
  
• d5dlcc_ appears in the current release, SCOPe 2.08