| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) ![]() |
| Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
| Protein automated matches [191177] (4 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [276963] (1 PDB entry) |
| Domain d5dlcc_: 5dlc C: [276965] automated match to d3gk0a_ complexed with po4 |
PDB Entry: 5dlc (more details), 2.65 Å
SCOPe Domain Sequences for d5dlcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dlcc_ c.1.24.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
trillgvnidhvatlrqargtrypdpvkaaldaeeagadgitvhlredrrhiqerdvrvl
kevlqtrmnfemgvteemlafaeeirpahsclvperreeltteggldvagqeqrirdavr
rlaavgsevslfidpdprqieasarvgapaielhtgryadaedpeeqarelqrvregval
grslglivnaghglhyhnvepvaaidginelnighaivahalfvgfrqavaemkalmlaa
at
Timeline for d5dlcc_: