| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
| Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins) automatically mapped to Pfam PF03936 |
| Protein automated matches [227033] (2 species) not a true protein |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (23 PDB entries) |
| Domain d5dhka2: 5dhk A:221-548 [276961] Other proteins in same PDB: d5dhka1 automated match to d3m00a2 complexed with far, mg; mutant |
PDB Entry: 5dhk (more details), 2.43 Å
SCOPe Domain Sequences for d5dhka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dhka2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfealgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpekvlkphiinllvdsiki
Timeline for d5dhka2: