Lineage for d1aofa2 (1aof A:134-567)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803668Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1803728Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 1803729Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 1803730Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 1803736Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 1803751Domain d1aofa2: 1aof A:134-567 [27696]
    Other proteins in same PDB: d1aofa1, d1aofb1
    complexed with dhe, hem, so2

Details for d1aofa2

PDB Entry: 1aof (more details), 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1aofa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aofa2 b.70.2.1 (A:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
ppefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvl
dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
vnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtke
gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
tgkfnvyntmtdty

SCOPe Domain Coordinates for d1aofa2:

Click to download the PDB-style file with coordinates for d1aofa2.
(The format of our PDB-style files is described here.)

Timeline for d1aofa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aofa1