SCOPe 2.08: Domain d5dhia2: 5dhi A:221-548

Lineage for d5dhia2 (5dhi A:221-548)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
   automatically mapped to Pfam PF03936

6. Protein automated matches [227033] (2 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (23 PDB entries)

8. Domain d5dhia2: 5dhi A:221-548 [276953]
   Other proteins in same PDB: d5dhia1
   automated match to d3m00a2
   complexed with mg; mutant

Details for d5dhia2

PDB Entry: 5dhi, 2.25 Å

PDB Description: nicotiana tabacum 5-epi-aristolochene synthase mutant w273e - nonalkylated

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5dhia2:

Sequence; same for both SEQRES and ATOM records:

>d5dhia2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfealgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpekvlkphiinllvdsiki

Timeline for d5dhia2:

• d5dhia2 first appeared in SCOPe 2.05
  
• d5dhia2 appears in SCOPe 2.07