![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) ![]() |
![]() | Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein) |
![]() | Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (4 species) the N-terminal domain is cytochrome c-like |
![]() | Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries) formerly Thiosphaera pantotropha |
![]() | Domain d1aomb2: 1aom B:134-567 [27695] Other proteins in same PDB: d1aomb1 complexed with 2no, dhe, hem, no |
PDB Entry: 1aom (more details), 1.8 Å
SCOPe Domain Sequences for d1aomb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aomb2 b.70.2.1 (B:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} ppefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvl dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi vnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtke gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp tgkfnvyntmtdty
Timeline for d1aomb2: