Lineage for d1aoma1 (1aom A:129-567)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675578Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 675614Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 675615Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 675616Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 675622Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 675633Domain d1aoma1: 1aom A:129-567 [27694]
    Other proteins in same PDB: d1aomb1

Details for d1aoma1

PDB Entry: 1aom (more details), 1.8 Å

PDB Description: substrate and product bound to cytochrome cd1 nitrite reductase
PDB Compounds: (A:) nitrite reductase

SCOP Domain Sequences for d1aoma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoma1 b.70.2.1 (A:129-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
rlvtptgkfnvyntmtdty

SCOP Domain Coordinates for d1aoma1:

Click to download the PDB-style file with coordinates for d1aoma1.
(The format of our PDB-style files is described here.)

Timeline for d1aoma1: