Lineage for d5depc_ (5dep C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2080029Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2080030Protein automated matches [190967] (30 species)
    not a true protein
  7. 2080167Species Pseudomonas aeruginosa [TaxId:381754] [276926] (3 PDB entries)
  8. 2080176Domain d5depc_: 5dep C: [276928]
    automated match to d2qiaa_
    complexed with po4, ud1

Details for d5depc_

PDB Entry: 5dep (more details), 2.16 Å

PDB Description: structure of pseudomonas aeruginosa lpxa in complex with udp-glcnac
PDB Compounds: (C:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5depc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5depc_ b.81.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs
svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd
svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt
vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev
avfrdsiqsatrgitr

SCOPe Domain Coordinates for d5depc_:

Click to download the PDB-style file with coordinates for d5depc_.
(The format of our PDB-style files is described here.)

Timeline for d5depc_: