Lineage for d5deid2 (5dei D:183-342)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843195Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1843219Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 1843220Species Pseudomonas putida [TaxId:303] [52483] (41 PDB entries)
    Uniprot P20906
  8. 1843256Domain d5deid2: 5dei D:183-342 [276921]
    Other proteins in same PDB: d5deia1, d5deia3, d5deib1, d5deib3, d5deic1, d5deic3, d5deid1, d5deid3
    automated match to d1q6za1
    complexed with bct, ca, mg, tdp

Details for d5deid2

PDB Entry: 5dei (more details), 1.3 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida
PDB Compounds: (D:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d5deid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5deid2 c.31.1.3 (D:183-342) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d5deid2:

Click to download the PDB-style file with coordinates for d5deid2.
(The format of our PDB-style files is described here.)

Timeline for d5deid2: