Lineage for d1aoqa2 (1aoq A:134-567)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62941Fold b.70: 8-bladed beta-propeller [50997] (2 superfamilies)
  4. 62961Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 62962Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 62963Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
  7. 62969Species Paracoccus pantotrophus [TaxId:82367] [51007] (10 PDB entries)
  8. 62978Domain d1aoqa2: 1aoq A:134-567 [27692]
    Other proteins in same PDB: d1aoqa1, d1aoqb1

Details for d1aoqa2

PDB Entry: 1aoq (more details), 1.8 Å

PDB Description: cytochrome cd1 nitrite reductase with substrate and product bound

SCOP Domain Sequences for d1aoqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoqa2 b.70.2.1 (A:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
ppefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvl
dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
vnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtke
gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
tgkfnvyntmtdty

SCOP Domain Coordinates for d1aoqa2:

Click to download the PDB-style file with coordinates for d1aoqa2.
(The format of our PDB-style files is described here.)

Timeline for d1aoqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aoqa1