Lineage for d5cvjb2 (5cvj B:123-368)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500870Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2500911Protein automated matches [226979] (4 species)
    not a true protein
  7. 2500912Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries)
  8. 2500920Domain d5cvjb2: 5cvj B:123-368 [276898]
    Other proteins in same PDB: d5cvja1, d5cvjb1, d5cvjc1, d5cvjd1
    automated match to d1kyzc2
    complexed with n7i, no3, sah

Details for d5cvjb2

PDB Entry: 5cvj (more details), 1.8 Å

PDB Description: monolignol 4-o-methyltransferase 5 - coniferyl alcohol
PDB Compounds: (B:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cvjb2 c.66.1.12 (B:123-368) automated matches {Clarkia breweri [TaxId: 36903]}
dgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkg
mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda
pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi
lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm
eflkta

SCOPe Domain Coordinates for d5cvjb2:

Click to download the PDB-style file with coordinates for d5cvjb2.
(The format of our PDB-style files is described here.)

Timeline for d5cvjb2: