| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
| Protein automated matches [226979] (4 species) not a true protein |
| Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries) |
| Domain d5cvja2: 5cvj A:123-367 [276894] Other proteins in same PDB: d5cvja1, d5cvjb1, d5cvjc1, d5cvjd1 automated match to d1kyzc2 complexed with n7i, no3, sah |
PDB Entry: 5cvj (more details), 1.8 Å
SCOPe Domain Sequences for d5cvja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cvja2 c.66.1.12 (A:123-367) automated matches {Clarkia breweri [TaxId: 36903]}
dgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkg
mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda
pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi
lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm
eflkt
Timeline for d5cvja2: