| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries) |
| Domain d5cvva1: 5cvv A:16-122 [276891] Other proteins in same PDB: d5cvva2, d5cvvb2 automated match to d1kyze1 complexed with n7i, sah |
PDB Entry: 5cvv (more details), 1.73 Å
SCOPe Domain Sequences for d5cvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cvva1 a.4.5.0 (A:16-122) automated matches {Clarkia breweri [TaxId: 36903]}
ssdeeanlfahqlaraaslpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpe
apvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
Timeline for d5cvva1: