SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5cnba_ (5cnb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978087Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)
  8. 1978166Domain d5cnba_: 5cnb A: [276884]
    automated match to d3vm9a_
    complexed with cmo, hem, so4

Details for d5cnba_

PDB Entry: 5cnb (more details), 1.8 Å

PDB Description: ultrafast dynamics in myoglobin: 0.5 ps time delay
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5cnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cnba_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d5cnba_:

Click to download the PDB-style file with coordinates for d5cnba_.
(The format of our PDB-style files is described here.)

Timeline for d5cnba_: