Lineage for d5cn4a_ (5cn4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687855Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)
  8. 2687939Domain d5cn4a_: 5cn4 A: [276881]
    automated match to d3vm9a_
    complexed with cmo, hem, so4

Details for d5cn4a_

PDB Entry: 5cn4 (more details), 1.8 Å

PDB Description: ultrafast dynamics in myoglobin: -0.1 ps time delay
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5cn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cn4a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d5cn4a_:

Click to download the PDB-style file with coordinates for d5cn4a_.
(The format of our PDB-style files is described here.)

Timeline for d5cn4a_: