Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (5 species) not a true protein |
Species Ovis aries [TaxId:9940] [276868] (1 PDB entry) |
Domain d5abmd_: 5abm D: [276872] automated match to d1o9ja_ complexed with mg, txe |
PDB Entry: 5abm (more details), 1.7 Å
SCOPe Domain Sequences for d5abmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5abmd_ c.82.1.1 (D:) automated matches {Ovis aries [TaxId: 9940]} dvpapltnlqfkytkifinnewhssvsgkkfpvfnpateeklceveegdkedvdkavkaa rqafqigspwrtmdasergrllnkladlierdrlllatmeamnggklfsnaylmdlggci ktlrycagwadkiqgrtipmdgnfftytrsepvgvcgqiipwnfpllmflwkigpalscg ntvvvkpaeqtpltalhmgslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs tevgklikeaagksnlkrvslelggkspcivfadadldnavefahqgvfyhqgqcciaas rlfveesiydefvrrsverakkyvlgnpltpgvsqgpqidkeqyekildliesgkkegak lecgggpwgnkgyfiqptvfsdvtddmriakeeifgpvqqimkfkslddvikranntfyg lsagiftndidkaitvssalqsgtvwvncysvvsaqcpfggfkmsgngrelgeygfheyt evktvtikisqkns
Timeline for d5abmd_: