Lineage for d5abmc_ (5abm C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140987Protein automated matches [190401] (5 species)
    not a true protein
  7. 2141027Species Sheep (Ovis aries) [TaxId:9940] [276868] (1 PDB entry)
  8. 2141030Domain d5abmc_: 5abm C: [276870]
    automated match to d1o9ja_
    complexed with mg, txe

Details for d5abmc_

PDB Entry: 5abm (more details), 1.7 Å

PDB Description: sheep aldehyde dehydrogenase 1a1
PDB Compounds: (C:) Retinal dehydrogenase 1

SCOPe Domain Sequences for d5abmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abmc_ c.82.1.1 (C:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
dvpapltnlqfkytkifinnewhssvsgkkfpvfnpateeklceveegdkedvdkavkaa
rqafqigspwrtmdasergrllnkladlierdrlllatmeamnggklfsnaylmdlggci
ktlrycagwadkiqgrtipmdgnfftytrsepvgvcgqiipwnfpllmflwkigpalscg
ntvvvkpaeqtpltalhmgslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs
tevgklikeaagksnlkrvslelggkspcivfadadldnavefahqgvfyhqgqcciaas
rlfveesiydefvrrsverakkyvlgnpltpgvsqgpqidkeqyekildliesgkkegak
lecgggpwgnkgyfiqptvfsdvtddmriakeeifgpvqqimkfkslddvikranntfyg
lsagiftndidkaitvssalqsgtvwvncysvvsaqcpfggfkmsgngrelgeygfheyt
evktvtikisqkns

SCOPe Domain Coordinates for d5abmc_:

Click to download the PDB-style file with coordinates for d5abmc_.
(The format of our PDB-style files is described here.)

Timeline for d5abmc_: