Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [258369] (4 PDB entries) |
Domain d4zevb_: 4zev B: [276863] automated match to d2b30a1 complexed with m6p, mg, po4 |
PDB Entry: 4zev (more details), 1.8 Å
SCOPe Domain Sequences for d4zevb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zevb_ c.108.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} ndeikiiftaldgtllnsenkvseqnlesliraqekgikvviatgrsifsvenvigehvk knrisllpgiymngcvtfdekgsrvidrimnndlkmeihefskqiniskyaiwfclekty cfeindcireymevealnpdviednmlegltvykvlfslpenilentlklcrekfshrin vantfqsyvelfhqhtnkfegvkeickyynislnnalamgdgendiemlsglthsvgvhn asekvknsaayvgpsnnehaishvlktfcd
Timeline for d4zevb_: