Lineage for d4yuxb_ (4yux B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502752Species Trypanosoma cruzi [TaxId:353153] [188400] (13 PDB entries)
  8. 2502760Domain d4yuxb_: 4yux B: [276833]
    automated match to d2o06a_
    complexed with 4jt, s4m

Details for d4yuxb_

PDB Entry: 4yux (more details), 1.6 Å

PDB Description: crystal structure of trypanosoma cruzi spermidine synthase in complex with 2h-1,4-benzothiazin-3-amine
PDB Compounds: (B:) Spermidine synthase, putative

SCOPe Domain Sequences for d4yuxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yuxb_ c.66.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mpgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmald
gciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdid
gevmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklf
geafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcg
sigtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn

SCOPe Domain Coordinates for d4yuxb_:

Click to download the PDB-style file with coordinates for d4yuxb_.
(The format of our PDB-style files is described here.)

Timeline for d4yuxb_: