![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:353153] [188400] (13 PDB entries) |
![]() | Domain d4yuxa_: 4yux A: [276829] automated match to d2o06a_ complexed with 4jt, s4m |
PDB Entry: 4yux (more details), 1.6 Å
SCOPe Domain Sequences for d4yuxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yuxa_ c.66.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]} pgselisggwfreendqwpgqamslrvekvlydaptkfqhltifesdpkgpwgtvmaldg ciqvtdydefvyhevlghtslcshpkpervliigggdggvlrevlrhgtvehcdlvdidg evmeqskqhfpqisrsladpratvrvgdglafvrqtpdntydvviidttdpagpasklfg eafykdvlrilkpdgiccnqgesiwldleliekmsrfiretgfasvqyalmhvptypcgs igtlvcskkagvdvtkplrpvedmpfakdlkyydsemhkasfalprfarhinn
Timeline for d4yuxa_: