Lineage for d4ym2c_ (4ym2 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781960Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)
  8. 1782050Domain d4ym2c_: 4ym2 C: [276824]
    automated match to d2zhma_
    complexed with bgc, lat, sga

Details for d4ym2c_

PDB Entry: 4ym2 (more details), 2.1 Å

PDB Description: crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
PDB Compounds: (C:) Galectin-4

SCOPe Domain Sequences for d4ym2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ym2c_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
fqrvdtleiqgdvtlsyvqi

SCOPe Domain Coordinates for d4ym2c_:

Click to download the PDB-style file with coordinates for d4ym2c_.
(The format of our PDB-style files is described here.)

Timeline for d4ym2c_: