| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
| Domain d4ym2c_: 4ym2 C: [276824] automated match to d2zhma_ |
PDB Entry: 4ym2 (more details), 2.1 Å
SCOPe Domain Sequences for d4ym2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ym2c_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
fqrvdtleiqgdvtlsyvqi
Timeline for d4ym2c_: